TRIM10 (NM_052828) Human Mass Spec Standard
CAT#: PH310882
TRIM10 MS Standard C13 and N15-labeled recombinant protein (NP_439893)
View other "TRIM10" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TRIM10 MS Standard C13 and N15-labeled recombinant protein (NP_439893) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210882 |
Predicted MW | 45.3 kDa |
Protein Sequence |
>RC210882 protein sequence
Red=Cloning site Green=Tags(s) MASAASVTSLADEVNCPICQGTLREPVTIDCGHNFCRACLTRYCEIPGPDLEESPTCPLCKEPFRPGSFR PNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVVCREAGEHATHTMRFLEDAAA PYREQIHKCLKCLRKEREEIQEIQSRENKRMQVLLTQVSTKRQQVISEFAHLRKFLEEQQSILLAQLESQ DGDILRQRDEFDLLVAGEICRFSALIEELEEKNERPARELLTDIRSTLIRCETRKCRKPVAVSPELGQRI RDFPQQALPLQREMKMFLEKLCFELDYEPAHISLDPQTSHPKLLLSEDHQRAQFSYKWQNSPDNPQRFDR ATCVLAHTGITGGRHTWVWMARVPGDSGCCQFCSPPSVLGTEVAA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_439893 |
RefSeq Size | 3033 |
RefSeq ORF | 1185 |
Synonyms | HERF1; RFB30; RNF9 |
Locus ID | 10107 |
Cytogenetics | 6p22.1 |
Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409443 | TRIM10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416423 | TRIM10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY409443 | Transient overexpression lysate of tripartite motif-containing 10 (TRIM10), transcript variant 2 |
CNY 3080.00 |
|
LY416423 | Transient overexpression lysate of tripartite motif-containing 10 (TRIM10), transcript variant 1 |
CNY 4840.00 |
|
TP310882 | Recombinant protein of human tripartite motif-containing 10 (TRIM10), transcript variant 2, 20 µg |
CNY 2900.00 |