GPHA2 (NM_130769) Human Mass Spec Standard
CAT#: PH310893
GPHA2 MS Standard C13 and N15-labeled recombinant protein (NP_570125)
View other "GPHA2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GPHA2 MS Standard C13 and N15-labeled recombinant protein (NP_570125) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210893 |
| Predicted MW | 14.2 kDa |
| Protein Sequence |
>RC210893 protein sequence
Red=Cloning site Green=Tags(s) MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRY SVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_570125 |
| RefSeq Size | 774 |
| RefSeq ORF | 387 |
| Synonyms | A2; GPA2; ZSIG51 |
| Locus ID | 170589 |
| Cytogenetics | 11q13.1 |
| Summary | GPHA2 is a cystine knot-forming polypeptide and a subunit of the dimeric glycoprotein hormone family (Hsu et al., 2002 [PubMed 12089349]).[supplied by OMIM, Mar 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408932 | GPHA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408932 | Transient overexpression lysate of glycoprotein hormone alpha 2 (GPHA2) |
CNY 3080.00 |
|
| TP310893 | Recombinant protein of human glycoprotein hormone alpha 2 (GPHA2), 20 µg |
CNY 2900.00 |
