WFDC6 (NM_080827) Human Mass Spec Standard
CAT#: PH310952
WFDC6 MS Standard C13 and N15-labeled recombinant protein (NP_543017)
View other "WFDC6" proteins (3)
| Need it in bulk or customized? Get a free quote | 
CNY 19520.00
Specifications
| Product Data | |
| Description | WFDC6 MS Standard C13 and N15-labeled recombinant protein (NP_543017) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC210952 | 
| Predicted MW | 9.7 kDa | 
| Protein Sequence | >RC210952 protein sequence Red=Cloning site Green=Tags(s) MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCL DFRKVSLTLYHKEELE myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_543017 | 
| RefSeq Size | 619 | 
| RefSeq ORF | 258 | 
| Synonyms | C20orf171; dJ461P17.11; HEL-S-295; WAP6 | 
| Locus ID | 140870 | 
| Cytogenetics | 20q13.12 | 
| Summary | This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Read-through transcription exists between this gene and the upstream SPINLW1 (serine peptidase inhibitor-like, with Kunitz and WAP domains 1) gene. [provided by RefSeq, Nov 2010] | 
| Protein Families | Secreted Protein | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC409030 | WFDC6 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY409030 | Transient overexpression lysate of WAP four-disulfide core domain 6 (WFDC6) | CNY 3080.00 | |
| TP310952 | Recombinant protein of human WAP four-disulfide core domain 6 (WFDC6), 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        

 
        