ERAS (NM_181532) Human Mass Spec Standard
CAT#: PH310965
ERAS MS Standard C13 and N15-labeled recombinant protein (NP_853510)
View other "ERAS" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ERAS MS Standard C13 and N15-labeled recombinant protein (NP_853510) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210965 |
| Predicted MW | 25.3 kDa |
| Protein Sequence |
>RC210965 protein sequence
Red=Cloning site Green=Tags(s) MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDH DPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGP HPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEP MARSCREKTRHQKATCHCGCSVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_853510 |
| RefSeq Size | 826 |
| RefSeq ORF | 699 |
| Synonyms | HRAS2; HRASP |
| Locus ID | 3266 |
| Cytogenetics | Xp11.23 |
| Summary | This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. [provided by RefSeq, Dec 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405694 | ERAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405694 | Transient overexpression lysate of ES cell expressed Ras (ERAS) |
CNY 3080.00 |
|
| TP310965 | Recombinant protein of human ES cell expressed Ras (ERAS), 20 µg |
CNY 2900.00 |
