CYP7A1 (NM_000780) Human Mass Spec Standard
CAT#: PH311019
CYP7A1 MS Standard C13 and N15-labeled recombinant protein (NP_000771)
View other "CYP7A1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CYP7A1 MS Standard C13 and N15-labeled recombinant protein (NP_000771) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211019 |
| Predicted MW | 57.7 kDa |
| Protein Sequence |
>RC211019 protein sequence
Red=Cloning site Green=Tags(s) MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQRKHGHVFTCK LMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALNS LTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMFEAGYLTIFGRDLTRRDTQKAHILNNLDNFK QFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHL VVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSII KESLRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILP PLNDIEFKYKFKHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000771 |
| RefSeq Size | 2875 |
| RefSeq ORF | 1512 |
| Synonyms | CP7A; CYP7; CYPVII |
| Locus ID | 1581 |
| Cytogenetics | 8q12.1 |
| Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway in the liver, which converts cholesterol to bile acids. This reaction is the rate limiting step and the major site of regulation of bile acid synthesis, which is the primary mechanism for the removal of cholesterol from the body. Polymorphisms in the promoter of this gene are associated with defects in bile acid synthesis. [provided by RefSeq, Feb 2010] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, P450, Transmembrane |
| Protein Pathways | Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424522 | CYP7A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424522 | Transient overexpression lysate of cytochrome P450, family 7, subfamily A, polypeptide 1 (CYP7A1) |
CNY 3080.00 |
|
| TP311019 | Recombinant protein of human cytochrome P450, family 7, subfamily A, polypeptide 1 (CYP7A1), 20 µg |
CNY 2900.00 |
