C1orf77 (CHTOP) (NM_015607) Human Mass Spec Standard
CAT#: PH311107
C1orf77 MS Standard C13 and N15-labeled recombinant protein (NP_056422)
View other "C1orf77" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C1orf77 MS Standard C13 and N15-labeled recombinant protein (NP_056422) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211107 |
Predicted MW | 26.5 kDa |
Protein Sequence |
>RC211107 protein sequence
Red=Cloning site Green=Tags(s) MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALK LKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLL RGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARP VLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056422 |
RefSeq Size | 2172 |
RefSeq ORF | 747 |
Synonyms | C1orf77; C10orf77; FL-SRAG; FOP; pp7704; SRAG; SRAG-3; SRAG-5 |
Locus ID | 26097 |
Cytogenetics | 1q21.3 |
Summary | This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414453 | CHTOP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414453 | Transient overexpression lysate of chromosome 1 open reading frame 77 (C1orf77) |
CNY 3080.00 |
|
TP311107 | Recombinant protein of human chromosome 1 open reading frame 77 (C1orf77), 20 µg |
CNY 2900.00 |
其它C1orf77产品