BCL2L2 (NM_004050) Human Mass Spec Standard
CAT#: PH311152
BCL2L2 MS Standard C13 and N15-labeled recombinant protein (NP_004041)
View other "BCL2L2" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | BCL2L2 MS Standard C13 and N15-labeled recombinant protein (NP_004041) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC211152 | 
| Predicted MW | 20.8 kDa | 
| Protein Sequence | 
                 >RC211152 protein sequence 
Red=Cloning site Green=Tags(s) MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHS SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_004041 | 
| RefSeq Size | 3621 | 
| RefSeq ORF | 579 | 
| Synonyms | BCL-W; BCL2-L-2; BCLW; PPP1R51 | 
| Locus ID | 599 | 
| Cytogenetics | 14q11.2 | 
| Summary | This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. [provided by RefSeq, Dec 2010] | 
| Protein Families | Druggable Genome, Transmembrane | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401312 | BCL2L2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401312 | Transient overexpression lysate of BCL2-like 2 (BCL2L2) | 
                                                     CNY 3080.00  | 
                                            |
| TP311152 | Recombinant protein of human BCL2-like 2 (BCL2L2), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP720086 | Recombinant protein of human BCL2-like 2 (BCL2L2) | 
                                                     CNY 1800.00  | 
                                            
