Acetylcholinesterase (ACHE) (NM_015831) Human Mass Spec Standard
CAT#: PH311249
ACHE MS Standard C13 and N15-labeled recombinant protein (NP_056646)
View other "Acetylcholinesterase" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ACHE MS Standard C13 and N15-labeled recombinant protein (NP_056646) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211249 |
Predicted MW | 67.38 kDa |
Protein Sequence |
>RC211249 representing NM_015831
Red=Cloning site Green=Tags(s) MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAE PPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPT SPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLA LQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRAT QLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPL DPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQAC AFWNRFLPKLLSATASEAPSTCPGFTHGEAAPRPGLPLPLLLLHQLLLLFLSHLRRL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056646 |
RefSeq Size | 2978 |
RefSeq ORF | 1851 |
Synonyms | ACEE; ARACHE; N-ACHE; YT |
Locus ID | 43 |
Cytogenetics | 7q22.1 |
Summary | Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood group antigen. Acetylcholinesterase exists in multiple molecular forms which possess similar catalytic properties, but differ in their oligomeric assembly and mode of cell attachment to the cell surface. It is encoded by the single ACHE gene, and the structural diversity in the gene products arises from alternative mRNA splicing, and post-translational associations of catalytic and structural subunits. The major form of acetylcholinesterase found in brain, muscle and other tissues is the hydrophilic species, which forms disulfide-linked oligomers with collagenous, or lipid-containing structural subunits. The other, alternatively spliced form, expressed primarily in the erythroid tissues, differs at the C-terminal end, and contains a cleavable hydrophobic peptide with a GPI-anchor site. It associates with the membranes through the phosphoinositide (PI) moieties added post-translationally. AChE activity may constitute a sensitive biomarker of RBC ageing in vivo, and thus, may be of aid in understanding the effects of transfusion[provided by RefSeq, Sep 2019] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerophospholipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414362 | ACHE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424577 | ACHE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425009 | ACHE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414362 | Transient overexpression lysate of acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E5 |
CNY 3080.00 |
|
LY424577 | Transient overexpression lysate of acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E6 |
CNY 3080.00 |
|
LY425009 | Transient overexpression lysate of acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E6 |
CNY 3080.00 |
|
TP311249 | Recombinant protein of human acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E5, 20 µg |
CNY 2900.00 |
其它Acetylcholinesterase产品