TNFRSF4 (NM_003327) Human Mass Spec Standard
CAT#: PH311253
TNFRSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003318)
View other "TNFRSF4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TNFRSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003318) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211253 |
| Predicted MW | 29.3 kDa |
| Protein Sequence |
>RC211253 protein sequence
Red=Cloning site Green=Tags(s) MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPG FYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQA CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP GGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003318 |
| RefSeq Size | 1120 |
| RefSeq ORF | 831 |
| Synonyms | ACT35; CD134; IMD16; OX40; TXGP1L |
| Locus ID | 7293 |
| Cytogenetics | 1p36.33 |
| Summary | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418746 | TNFRSF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418746 | Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 4 (TNFRSF4) |
CNY 3080.00 |
|
| TP311253 | Recombinant protein of human tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), 20 µg |
CNY 2900.00 |
|
| TP700284 | Purified recombinant protein of human tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
| TP723945 | Human OX40 Protein, hFc-His tag |
CNY 5249.00 |
其它TNFRSF4产品
