5HT5A receptor (HTR5A) (NM_024012) Human Mass Spec Standard
CAT#: PH311300
HTR5A MS Standard C13 and N15-labeled recombinant protein (NP_076917)
View other "5HT5A receptor" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HTR5A MS Standard C13 and N15-labeled recombinant protein (NP_076917) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211300 |
| Predicted MW | 40.3 kDa |
| Protein Sequence |
>RC211300 protein sequence
Red=Cloning site Green=Tags(s) MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRT FHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRY WSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFY LPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK NFFSRQH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_076917 |
| RefSeq Size | 4572 |
| RefSeq ORF | 1071 |
| Synonyms | 5-HT5A |
| Locus ID | 3361 |
| Cytogenetics | 7q36.2 |
| Summary | The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
| Protein Pathways | Calcium signaling pathway, Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402973 | HTR5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402973 | Transient overexpression lysate of 5-hydroxytryptamine (serotonin) receptor 5A (HTR5A) |
CNY 3080.00 |
|
| TP311300 | Recombinant protein of human 5-hydroxytryptamine (serotonin) receptor 5A (HTR5A), 20 µg |
CNY 2900.00 |
其它5HT5A receptor产品
