PRDM12 (NM_021619) Human Mass Spec Standard
CAT#: PH311434
PRDM12 MS Standard C13 and N15-labeled recombinant protein (NP_067632)
View other "PRDM12" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PRDM12 MS Standard C13 and N15-labeled recombinant protein (NP_067632) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211434 |
| Predicted MW | 40.2 kDa |
| Protein Sequence |
>RC211434 representing NM_021619
Red=Cloning site Green=Tags(s) MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLFEDKSHHASPKTAFTAEVLAQ SFSGEVQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVF NEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL GIPGVPGLEEDQKKNKHEDFHPADSAAGPAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRF SQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAA AAAAAAAAAHHLPAMVL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_067632 |
| RefSeq Size | 2492 |
| RefSeq ORF | 1101 |
| Synonyms | HSAN8; PFM9 |
| Locus ID | 59335 |
| Cytogenetics | 9q34.12 |
| Summary | This gene encodes a transcriptional regulator of sensory neuronal specification that plays a critical role in pain perception. The encoded protein contains an N-terminal PRDI-BF1 and RIZ homology (PR) domain, a SET domain, and three C-terminal C2H2 zinc finger DNA-binding domains. Naturally occurring mutations in this gene are associated with congenital insensitivity to pain (CIP), and hereditary sensory and autonomic neuropathies (HSAN's) affecting peripheral sensory and autonomic neurons. Deregulation of this gene is associated with solid cancers and hematological malignancies including chronic myeloid leukaemia. [provided by RefSeq, Mar 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411971 | PRDM12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411971 | Transient overexpression lysate of PR domain containing 12 (PRDM12) |
CNY 3080.00 |
|
| TP311434 | Recombinant protein of human PR domain containing 12 (PRDM12), 20 µg |
CNY 2900.00 |
