COP (CARD16) (NM_052889) Human Mass Spec Standard
CAT#: PH311537
CARD16 MS Standard C13 and N15-labeled recombinant protein (NP_443121)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CARD16 MS Standard C13 and N15-labeled recombinant protein (NP_443121) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211537 |
Predicted MW | 10.6 kDa |
Protein Sequence |
>RC211537 representing NM_052889
Red=Cloning site Green=Tags(s) MRKAMADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGA QACQICITYICEEDSYLAETLGLSAGPIPGN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_443121 |
RefSeq Size | 758 |
RefSeq ORF | 303 |
Synonyms | COP; COP1; PSEUDO-ICE |
Locus ID | 114769 |
Cytogenetics | 11q22.3 |
Summary | Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. Also induces NF-kappa-B activation during the pro-inflammatory cytokine response. Also able to inhibit CASP1-mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, and staurosporine-mediated cell death but not ER stress-mediated cell death. Acts by preventing activation of caspases CASP1 and CASP4, possibly by preventing the interaction between CASP1 and RIPK2.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409399 | CARD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422744 | CARD16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409399 | Transient overexpression lysate of caspase recruitment domain family, member 16 (CARD16), transcript variant 2 |
CNY 3080.00 |
|
LY422744 | Transient overexpression lysate of caspase recruitment domain family, member 16 (CARD16), transcript variant 1 |
CNY 3080.00 |
|
TP311537 | Recombinant protein of human caspase recruitment domain family, member 16 (CARD16), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP760353 | Purified recombinant protein of Human caspase recruitment domain family, member 16 (CARD16), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |