SPANXA1 (NM_013453) Human Mass Spec Standard

Specifications

Product Data
Description	SPANXA1 MS Standard C13 and N15-labeled recombinant protein (NP_038481)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC211653
Predicted MW	11 kDa
Protein Sequence	Sequence Link (showhide) >RC211653 protein sequence Red=Cloning site Green=Tags(s) MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLND HARENRINPLQMEEEEFMEIMVEIPAK myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_038481
RefSeq Size	418
RefSeq ORF	291
Synonyms	CT11.1; CT11.3; NAP-X; SPAN-X; SPAN-Xa; SPAN-Xb; SPANX; SPANX-A
Locus ID	30014
Cytogenetics	Xq27.2
Summary	Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-head orientation with SPANX family member A2, which appears to be a duplication of the A1 locus. The protein encoded by this gene targets to the nucleus where it associates with nuclear vacuoles and the redundant nuclear envelope. Based on its association with these poorly characterized regions of the sperm nucleus, this protein provides a biochemical marker to study unique structures in spermatazoa while attempting to further define its role in spermatogenesis. [provided by RefSeq, Jul 2008]

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.