AMELY (NM_001143) Human Mass Spec Standard
CAT#: PH312029
AMELY MS Standard C13 and N15-labeled recombinant protein (NP_001134)
View other "AMELY" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | AMELY MS Standard C13 and N15-labeled recombinant protein (NP_001134) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212029 |
| Predicted MW | 21.73 kDa |
| Protein Sequence |
>RC212029 representing NM_001143
Red=Cloning site Green=Tags(s) MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVV SQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQP MQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001134 |
| RefSeq Size | 802 |
| RefSeq ORF | 576 |
| Synonyms | AMGL; AMGY |
| Locus ID | 266 |
| Cytogenetics | Yp11.2 |
| Summary | This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420106 | AMELY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420106 | Transient overexpression lysate of amelogenin, Y-linked (AMELY) |
CNY 3080.00 |
|
| TP312029 | Recombinant protein of human amelogenin, Y-linked (AMELY), 20 µg |
CNY 2900.00 |
