DNALI1 (NM_003462) Human Mass Spec Standard
CAT#: PH312111
DNALI1 MS Standard C13 and N15-labeled recombinant protein (NP_003453)
View other "DNALI1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | DNALI1 MS Standard C13 and N15-labeled recombinant protein (NP_003453) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212111 |
Predicted MW | 31.7 kDa |
Protein Sequence |
>RC212111 representing NM_003462
Red=Cloning site Green=Tags(s) MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPP KTKLPSTPCVPDPTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARET GICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSD MERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003453 |
RefSeq Size | 2663 |
RefSeq ORF | 840 |
Synonyms | dJ423B22.5; hp28; P28 |
Locus ID | 7802 |
Cytogenetics | 1p34.3 |
Summary | This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. [provided by RefSeq, Jul 2008] |
Protein Pathways | Huntington's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418664 | DNALI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418664 | Transient overexpression lysate of dynein, axonemal, light intermediate chain 1 (DNALI1) |
CNY 3080.00 |
|
TP312111 | Recombinant protein of human dynein, axonemal, light intermediate chain 1 (DNALI1), 20 µg |
CNY 2900.00 |