NDRG2 (NM_201537) Human Mass Spec Standard
CAT#: PH312237
NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963831)
View other "NDRG2" proteins (30)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963831) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212237 |
| Predicted MW | 40.6 kDa |
| Protein Sequence |
>RC212237 representing NM_201537
Red=Cloning site Green=Tags(s) MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHD VGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDELADMIPCVLQYLNFSTI IGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGN SELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDP TRTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLS QSSESGTLSSGPPGHTMEVSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_963831 |
| RefSeq Size | 2075 |
| RefSeq ORF | 1113 |
| Synonyms | SYLD |
| Locus ID | 57447 |
| Cytogenetics | 14q11.2 |
| Summary | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404442 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404443 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404444 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404445 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404446 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404447 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404448 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414093 | NDRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404442 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 1 |
CNY 3080.00 |
|
| LY404443 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 3 |
CNY 3080.00 |
|
| LY404444 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 4 |
CNY 3080.00 |
|
| LY404445 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 5 |
CNY 3080.00 |
|
| LY404446 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 6 |
CNY 3080.00 |
|
| LY404447 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 7 |
CNY 3080.00 |
|
| LY404448 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 8 |
CNY 3080.00 |
|
| LY414093 | Transient overexpression lysate of NDRG family member 2 (NDRG2), transcript variant 2 |
CNY 3080.00 |
|
| PH303712 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963832) |
CNY 19520.00 |
|
| PH310598 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963835) |
CNY 19520.00 |
|
| PH311577 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_057334) |
CNY 19520.00 |
|
| PH314708 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963834) |
CNY 14250.00 |
|
| PH319812 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963293) |
CNY 14250.00 |
|
| PH320003 | NDRG2 MS Standard C13 and N15-labeled recombinant protein (NP_963833) |
CNY 14250.00 |
|
| TP303712 | Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP310598 | Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 8, 20 µg |
CNY 2900.00 |
|
| TP311577 | Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP312237 | Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP314708 | Purified recombinant protein of Homo sapiens NDRG family member 2 (NDRG2), transcript variant 7, 20 µg |
CNY 2900.00 |
|
| TP319812 | Purified recombinant protein of Homo sapiens NDRG family member 2 (NDRG2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP320003 | Purified recombinant protein of Homo sapiens NDRG family member 2 (NDRG2), transcript variant 6, 20 µg |
CNY 2900.00 |
|
| TP760733 | Purified recombinant protein of Human NDRG family member 2 (NDRG2), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
