IL20 (NM_018724) Human Mass Spec Standard
CAT#: PH312397
IL20 MS Standard C13 and N15-labeled recombinant protein (NP_061194)
View other "IL20" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | IL20 MS Standard C13 and N15-labeled recombinant protein (NP_061194) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212397 |
| Predicted MW | 20.1 kDa |
| Protein Sequence |
>RC212397 protein sequence
Red=Cloning site Green=Tags(s) MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTES LQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMK KYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061194 |
| RefSeq Size | 1252 |
| RefSeq ORF | 528 |
| Synonyms | IL-20; IL10D; ZCYTO10 |
| Locus ID | 50604 |
| Cytogenetics | 1q32.1 |
| Summary | The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412869 | IL20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412869 | Transient overexpression lysate of interleukin 20 (IL20) |
CNY 3080.00 |
|
| TP312397 | Recombinant protein of human interleukin 20 (IL20), 20 µg |
CNY 2900.00 |
|
| TP720126 | Recombinant protein of human interleukin 20 (IL20) |
CNY 1800.00 |
