PRR3 (NM_025263) Human Mass Spec Standard
CAT#: PH312403
PRR3 MS Standard C13 and N15-labeled recombinant protein (NP_079539)
View other "PRR3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PRR3 MS Standard C13 and N15-labeled recombinant protein (NP_079539) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212403 |
| Predicted MW | 20.6 kDa |
| Protein Sequence |
>RC212403 protein sequence
Red=Cloning site Green=Tags(s) MPKRKKQNHHQPPTQQQPPLPEREETGDEEDGSPIGPPSLLGPPPMANGKPGDPKSALHRGPPGSRGPLI PPLLSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTRGSFHKEQRNPRRLKSWSLIK NTCPPKDDPQVMEDKSDRPVCRHFAKKGHCRYEDLCAFYHPGVNGPPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079539 |
| RefSeq Size | 3404 |
| RefSeq ORF | 564 |
| Synonyms | CAT56 |
| Locus ID | 80742 |
| Cytogenetics | 6p21.33 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410821 | PRR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421446 | PRR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410821 | Transient overexpression lysate of proline rich 3 (PRR3), transcript variant 1 |
CNY 3080.00 |
|
| LY421446 | Transient overexpression lysate of proline rich 3 (PRR3), transcript variant 2 |
CNY 3080.00 |
|
| TP312403 | Recombinant protein of human proline rich 3 (PRR3), transcript variant 1, 20 µg |
CNY 2900.00 |

