Myosin (MYL5) (NM_002477) Human Mass Spec Standard
CAT#: PH312414
MYL5 MS Standard C13 and N15-labeled recombinant protein (NP_002468)
View other "Myosin" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MYL5 MS Standard C13 and N15-labeled recombinant protein (NP_002468) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212414 |
Predicted MW | 19.4 kDa |
Protein Sequence |
>RC212414 representing NM_002477
Red=Cloning site Green=Tags(s) MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDD ELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEE VDQMFQFASIDVAGNLDYKALSYVITHGEEKEE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002468 |
RefSeq Size | 661 |
RefSeq ORF | 519 |
Synonyms | MYLC2 |
Locus ID | 4636 |
Cytogenetics | 4p16.3 |
Summary | This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq, Jul 2008] |
Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419312 | MYL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419312 | Transient overexpression lysate of myosin, light chain 5, regulatory (MYL5) |
CNY 3080.00 |
|
TP312414 | Recombinant protein of human myosin, light chain 5, regulatory (MYL5), 20 µg |
CNY 2900.00 |