PID1 (NM_017933) Human Mass Spec Standard
CAT#: PH312451
PID1 MS Standard C13 and N15-labeled recombinant protein (NP_060403)
View other "PID1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PID1 MS Standard C13 and N15-labeled recombinant protein (NP_060403) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212451 |
| Predicted MW | 27.9 kDa |
| Protein Sequence |
>RC212451 representing NM_017933
Red=Cloning site Green=Tags(s) MPRIAGNHLMLEESRTCSSPELLDGVWPCQPLHFGLPASEMHFQTMLKSKLNVLTLKKEPLPAVIFHEPE AIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQ VWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLA HAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060403 |
| RefSeq Size | 2745 |
| RefSeq ORF | 744 |
| Synonyms | HMFN2073; NYGGF4; P-CLI1; PCLI1 |
| Locus ID | 55022 |
| Cytogenetics | 2q36.3 |
| Summary | Increases proliferation of preadipocytes without affecting adipocytic differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402631 | PID1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420294 | PID1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402631 | Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1 |
CNY 3080.00 |
|
| LY420294 | Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2 |
CNY 3080.00 |
|
| PH312505 | PID1 MS Standard C13 and N15-labeled recombinant protein (NP_001094288) |
CNY 14250.00 |
|
| TP312451 | Recombinant protein of human phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP312505 | Purified recombinant protein of Homo sapiens phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2, 20 µg |
CNY 2900.00 |


