PPAR gamma (PPARG) (NM_015869) Human Mass Spec Standard
CAT#: PH312502
PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953)
View other "PPAR gamma" proteins (17)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212502 |
| Predicted MW | 57.4 kDa |
| Protein Sequence |
>RC212502 representing NM_015869
Red=Cloning site Green=Tags(s) MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF SSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECR VCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDM NSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETD MSLHPLLQEIYKDLY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056953 |
| RefSeq Size | 1820 |
| RefSeq ORF | 1515 |
| Synonyms | CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma |
| Locus ID | 5468 |
| Cytogenetics | 3p25.2 |
| Summary | This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
| Protein Pathways | Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402467 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC408558 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408559 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417568 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430063 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402467 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 |
CNY 4840.00 |
|
| LY408558 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 |
CNY 3080.00 |
|
| LY408559 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
CNY 3080.00 |
|
| LY417568 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 |
CNY 3080.00 |
|
| LY430063 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
CNY 3080.00 |
|
| PH301538 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619726) |
CNY 19520.00 |
|
| PH312181 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619725) |
CNY 19520.00 |
|
| PH312449 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028) |
CNY 19520.00 |
|
| TP301538 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP312181 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP312449 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP312502 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2, 20 µg |
CNY 2900.00 |
其它PPAR gamma产品


