P15RS (RPRD1A) (NM_018170) Human Mass Spec Standard
CAT#: PH312551
RPRD1A MS Standard C13 and N15-labeled recombinant protein (NP_060640)
View other "P15RS" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RPRD1A MS Standard C13 and N15-labeled recombinant protein (NP_060640) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212551 |
| Predicted MW | 35.5 kDa |
| Protein Sequence |
>RC212551 representing NM_018170
Red=Cloning site Green=Tags(s) MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNS KRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTY EQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGE RLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELR SRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060640 |
| RefSeq Size | 4284 |
| RefSeq ORF | 936 |
| Synonyms | HsT3101; P15RS |
| Locus ID | 55197 |
| Cytogenetics | 18q12.2 |
| Summary | This gene encodes a cell-cycle and transcription regulatory protein. The encoded protein interacts with the cell cycle inhibitor cyclin-dependent kinase 4 inhibitor B and may function as a negative regulator of G(1)/S phase progression. This protein also forms homo- and hetrodimers with the protein, regulation of nuclear pre-mRNA domain-containing protein 1B, to form a scaffold that interacts with the C-terminal domain of RNA polymerase II subunit B1 and regulates several aspects of transcription. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 16. [provided by RefSeq, Dec 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413267 | RPRD1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413267 | Transient overexpression lysate of regulation of nuclear pre-mRNA domain containing 1A (RPRD1A) |
CNY 3080.00 |
|
| TP312551 | Recombinant protein of human regulation of nuclear pre-mRNA domain containing 1A (RPRD1A), 20 µg |
CNY 2900.00 |
