IL19 (NM_013371) Human Mass Spec Standard
CAT#: PH312571
IL19 MS Standard C13 and N15-labeled recombinant protein (NP_037503)
View other "IL19" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | IL19 MS Standard C13 and N15-labeled recombinant protein (NP_037503) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212571 |
Predicted MW | 20.45 kDa |
Protein Sequence |
>RC212571 representing NM_013371
Red=Cloning site Green=Tags(s) MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIK PLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVI HDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_037503 |
RefSeq Size | 1831 |
RefSeq ORF | 531 |
Synonyms | IL-10C; MDA1; NG.1; ZMDA1 |
Locus ID | 29949 |
Cytogenetics | 1q32.1 |
Summary | The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415631 | IL19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415631 | Transient overexpression lysate of interleukin 19 (IL19), transcript variant 2 |
CNY 3080.00 |
|
TP312571 | Recombinant protein of human interleukin 19 (IL19), transcript variant 2, 20 µg |
CNY 2900.00 |