TGF beta 2 (TGFB2) (NM_003238) Human Mass Spec Standard
CAT#: PH312624
TGFB2 MS Standard C13 and N15-labeled recombinant protein (NP_003229)
View other "TGF beta 2" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TGFB2 MS Standard C13 and N15-labeled recombinant protein (NP_003229) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212624 |
| Predicted MW | 47.6 kDa |
| Protein Sequence |
>RC212624 representing NM_003238
Red=Cloning site Green=Tags(s) MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPEVISI YNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFDVSAMEKN ASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEW LHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPH LLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGAC PYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003229 |
| RefSeq Size | 1695 |
| RefSeq ORF | 1242 |
| Synonyms | G-TSF; LDS4; TGF-beta2 |
| Locus ID | 7042 |
| Cytogenetics | 1q41 |
| Summary | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Cytokine-cytokine receptor interaction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401115 | TGFB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427631 | TGFB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401115 | Transient overexpression lysate of transforming growth factor, beta 2 (TGFB2), transcript variant 2 |
CNY 3080.00 |
|
| LY427631 | Transient overexpression lysate of transforming growth factor, beta 2 (TGFB2), transcript variant 1 |
CNY 3080.00 |
|
| TP312624 | Recombinant protein of human transforming growth factor, beta 2 (TGFB2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP723805 | Purified recombinant protein of Human transforming growth factor, beta 2 (TGFB2), transcript variant 1 |
CNY 7125.00 |
其它TGF beta 2产品
