KRTAP27-1 (NM_001077711) Human Mass Spec Standard
CAT#: PH312779
KRTAP27 MS Standard C13 and N15-labeled recombinant protein (NP_001071179)
View other "KRTAP27-1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | KRTAP27 MS Standard C13 and N15-labeled recombinant protein (NP_001071179) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212779 |
| Predicted MW | 22.2 kDa |
| Protein Sequence |
>RC212779 representing NM_001077711
Red=Cloning site Green=Tags(s) MPHSHCHSLRSFHNAPPLSAITHGTNPITFEDRLCLPSSFHSRTCFLDNFQETCNETTSCQMTNCEQDLF TDDSCVQSNCFPGVVQTTYSNSRPCERTACQSESSSAGLACVSQPCQSESTQQMGFVAQSCQPASLKGNS CPPKTSKSKNFETLERASSQCQCQSQNPESSSCRPLVNVAPEPQLLESSPGVEPTCCVTGGSQLPSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001071179 |
| RefSeq Size | 682 |
| RefSeq ORF | 621 |
| Locus ID | 643812 |
| Cytogenetics | 21q22.11 |
| Summary | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421490 | KRTAP27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421490 | Transient overexpression lysate of keratin associated protein 27-1 (KRTAP27-1) |
CNY 3080.00 |
|
| TP312779 | Recombinant protein of human keratin associated protein 27-1 (KRTAP27-1), 20 µg |
CNY 2900.00 |
其它KRTAP27-1产品

