NANOS2 (NM_001029861) Human Mass Spec Standard
CAT#: PH312815
NANOS2 MS Standard C13 and N15-labeled recombinant protein (NP_001025032)
View other "NANOS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NANOS2 MS Standard C13 and N15-labeled recombinant protein (NP_001025032) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212815 |
Predicted MW | 15.1 kDa |
Protein Sequence |
>RC212815 protein sequence
Red=Cloning site Green=Tags(s) MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNG ESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001025032 |
RefSeq Size | 1577 |
RefSeq ORF | 414 |
Synonyms | NOS2; ZC2HC12B |
Locus ID | 339345 |
Cytogenetics | 19q13.32 |
Summary | Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422478 | NANOS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422478 | Transient overexpression lysate of nanos homolog 2 (Drosophila) (NANOS2) |
CNY 3080.00 |
|
TP312815 | Recombinant protein of human nanos homolog 2 (Drosophila) (NANOS2), 20 µg |
CNY 2900.00 |