ALKBH3 (NM_139178) Human Mass Spec Standard
CAT#: PH312873
ALKBH3 MS Standard C13 and N15-labeled recombinant protein (NP_631917)
View other "ALKBH3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ALKBH3 MS Standard C13 and N15-labeled recombinant protein (NP_631917) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212873 |
| Predicted MW | 33.2 kDa |
| Protein Sequence |
>RC212873 representing NM_139178
Red=Cloning site Green=Tags(s) MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPR VIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIKEDITYQQPRLTAWYGELP YTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFG ATRTFEMRKKPPPEENGEYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_631917 |
| RefSeq Size | 1520 |
| RefSeq ORF | 841 |
| Synonyms | ABH3; DEPC-1; DEPC1; hABH3; PCA1 |
| Locus ID | 221120 |
| Cytogenetics | 11p11.2 |
| Summary | The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403381 | ALKBH3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403381 | Transient overexpression lysate of alkB, alkylation repair homolog 3 (E. coli) (ALKBH3) |
CNY 3080.00 |
|
| TP312873 | Recombinant protein of human alkB, alkylation repair homolog 3 (E. coli) (ALKBH3), 20 µg |
CNY 2900.00 |
