PTPN20B (PTPN20) (NM_001042363) Human Mass Spec Standard
CAT＃: PH312878
PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822)
View other "PTPN20B" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212878 |
| Predicted MW | 39 kDa |
| Protein Sequence |
>RC212878 representing NM_001042363
Red=Cloning site Green=Tags(s) MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILE EKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGE EYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQI LQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTG VFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035822 |
| RefSeq Size | 2872 |
| RefSeq ORF | 1017 |
| Synonyms | bA42B19.1; bA142I17.1; CT126; PTPN20A; PTPN20B |
| Locus ID | 26095 |
| Cytogenetics | 10q11.22 |
| Summary | The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414452 | PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420847 | PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420852 | PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414452 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 2 |
CNY 3080.00 |
|
| LY420847 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 3 |
CNY 3080.00 |
|
| LY420852 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8 |
CNY 3080.00 |
|
| TP312878 | Purified recombinant protein of Homo sapiens protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8, 20 µg |
CNY 2900.00 |
其它PTPN20B产品
