TAF1 48 (TAF1A) (NM_005681) Human Mass Spec Standard
CAT#: PH312971
TAF1A MS Standard C13 and N15-labeled recombinant protein (NP_005672)
View other "TAF1 48" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | TAF1A MS Standard C13 and N15-labeled recombinant protein (NP_005672) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212971 |
| Predicted MW | 52.5 kDa |
| Protein Sequence |
>RC212971 representing NM_005681
Red=Cloning site Green=Tags(s) MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQW QQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQH ALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNA VAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLY NFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWK YLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY ILKQDHQILGKKIKRMKRSVKKYSIVNPRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005672 |
| RefSeq Size | 1893 |
| RefSeq ORF | 1350 |
| Synonyms | MGC:17061; RAFI48; SL1; TAFI48 |
| Locus ID | 9015 |
| Cytogenetics | 1q41 |
| Summary | This gene encodes a subunit of the RNA polymerase I complex, Selectivity Factor I (SLI). The encoded protein is a TATA box-binding protein-associated factor that plays a role in the assembly of the RNA polymerase I preinitiation complex. Alternate splicing results in multiple transcript variants encoding multiple isoforms.[provided by RefSeq, Jan 2011] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401732 | TAF1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408297 | TAF1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401732 | Transient overexpression lysate of TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 1 |
CNY 3080.00 |
|
| LY408297 | Transient overexpression lysate of TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 2 |
CNY 3080.00 |
|
| TP312971 | Recombinant protein of human TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760550 | Purified recombinant protein of Human TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它TAF1 48产品
