Macrophage inflammatory protein 5 (CCL15) (NM_032964) Human Mass Spec Standard
CAT#: PH312975
CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_116740)
View other "Macrophage inflammatory protein 5" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_116740) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212975 |
| Predicted MW | 12.7 kDa |
| Protein Sequence |
>RC212975 representing NM_032964
Red=Cloning site Green=Tags(s) MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116740 |
| RefSeq Size | 1344 |
| RefSeq ORF | 339 |
| Synonyms | HCC-2; HMRP-2B; Lkn-1; LKN1; MIP-1d; MIP-5; NCC-3; NCC3; SCYA15; SCYL3; SY15 |
| Locus ID | 6359 |
| Cytogenetics | 17q12 |
| Summary | This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14). [provided by RefSeq, Jan 2013] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409848 | CCL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409849 | CCL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418174 | CCL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409848 | Transient overexpression lysate of chemokine (C-C motif) ligand 15 (CCL15), transcript variant 1 |
CNY 3080.00 |
|
| LY409849 | Transient overexpression lysate of chemokine (C-C motif) ligand 15 (CCL15) |
CNY 3080.00 |
|
| LY418174 | Transient overexpression lysate of chemokine (C-C motif) ligand 15 (CCL15), transcript variant 2 |
CNY 3080.00 |
|
| PH319289 | CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_004158) |
CNY 19520.00 |
|
| TP312975 | Recombinant protein of human chemokine (C-C motif) ligand 15 (CCL15), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP319289 | Recombinant protein of human chemokine (C-C motif) ligand 15 (CCL15), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Macrophage inflammatory protein 5产品
