TAFA3 (NM_182759) Human Mass Spec Standard
CAT#: PH313076
FAM19A3 MS Standard C13 and N15-labeled recombinant protein (NP_877436)
View other "TAFA3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | FAM19A3 MS Standard C13 and N15-labeled recombinant protein (NP_877436) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213076 |
| Predicted MW | 14.6 kDa |
| Protein Sequence |
>RC213076 representing NM_182759
Red=Cloning site Green=Tags(s) MSERVERNWSTGGWLLALCLAWLWTHLTLAALQPPTATVLVQQGTCEVIAAHRCCNRNRIEERSQTVKCS CFSGQVAGTTRAKPSCVDASIVLQRWWCQMEPCLPGEECKVLPDLSGWSCSSGHKVKTTKVTR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_877436 |
| RefSeq Size | 1077 |
| RefSeq ORF | 399 |
| Synonyms | FAM19A3; TAFA-3 |
| Locus ID | 284467 |
| Cytogenetics | 1p13.2 |
| Summary | This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403648 | FAM19A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423753 | FAM19A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403648 | Transient overexpression lysate of family with sequence similarity 19 (chemokine (C-C motif)-like), member A3 (FAM19A3), transcript variant 1 |
CNY 3080.00 |
|
| LY423753 | Transient overexpression lysate of family with sequence similarity 19 (chemokine (C-C motif)-like), member A3 (FAM19A3), transcript variant 2 |
CNY 3080.00 |
|
| TP313076 | Purified recombinant protein of Homo sapiens family with sequence similarity 19 (chemokine (C-C motif)-like), member A3 (FAM19A3), transcript variant 1, 20 µg |
CNY 2900.00 |
