TrkA (NTRK1) (NM_001012331) Human Mass Spec Standard
CAT#: PH313091
NTRK1 MS Standard C13 and N15-labeled recombinant protein (NP_001012331)
View other "TrkA" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | NTRK1 MS Standard C13 and N15-labeled recombinant protein (NP_001012331) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213091 |
Predicted MW | 86.7 kDa |
Protein Sequence |
>RC213091 representing NM_001012331
Red=Cloning site Green=Tags(s) MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTE LYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSL QELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNLTCWAENDVGRAEVSVQV NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQ PTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVEKKDETPFGVSVAVGLAV FACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQY FSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTM LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAA GMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTT ESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKD VHARLQALAQAPPVYLDVLG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001012331 |
RefSeq Size | 2647 |
RefSeq ORF | 2370 |
Synonyms | MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA |
Locus ID | 4914 |
Cytogenetics | 1q23.1 |
Summary | This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Apoptosis, Endocytosis, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Thyroid cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400383 | NTRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC419273 | NTRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC423326 | NTRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400383 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3 |
CNY 4840.00 |
|
LY419273 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 2 |
CNY 4840.00 |
|
LY423326 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1 |
CNY 4840.00 |
|
TP313091 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP700133 | Purified recombinant protein of Human neurotrophic tyrosine kinase receptor, type 1, transcript variant 2, with C-terminal DDK/His tag, expressed in human cells |
CNY 6650.00 |
|
TP700134 | Purified recombinant protein of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells |
CNY 6650.00 |
|
TP762465 | Purified recombinant protein of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 2, Asn440-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |