HSD17B13 (NM_178135) Human Mass Spec Standard
CAT＃: PH313132
HSD17B13 MS Standard C13 and N15-labeled recombinant protein (NP_835236)
View other "HSD17B13" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 4066.00
CNY 3080.00
Specifications
| Product Data | |
| Description | HSD17B13 MS Standard C13 and N15-labeled recombinant protein (NP_835236) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213132 |
| Predicted MW | 33.7 kDa |
| Protein Sequence |
>RC213132 protein sequence
Red=Cloning site Green=Tags(s) MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI LNRMQNIQFEAVVGHKIKMK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_835236 |
| RefSeq Size | 2397 |
| RefSeq ORF | 900 |
| Synonyms | HMFN0376; NIIL497; SCDR9; SDR16C3 |
| Locus ID | 345275 |
| Cytogenetics | 4q22.1 |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405941 | HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427863 | HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC440268 | HSD17B13, transcript variant D, HEK 293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC440269 | HSD17B13, transcript variant C, HEK 293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405941 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A |
CNY 3080.00 |
|
| LY427863 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant B |
CNY 3080.00 |
|
| LY440268 | Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant D |
CNY 2990.00 |
|
| LY440269 | Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant C |
CNY 2990.00 |
|
| TP313132 | Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A, 20 µg |
CNY 2900.00 |
其它HSD17B13产品
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A, 100 µg
