C2orf88 (NM_032321) Human Mass Spec Standard
CAT#: PH313211
C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_115697)
View other "C2orf88" proteins (15)
| Need it in bulk or customized? Get a free quote | 
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_115697) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC213211 | 
| Predicted MW | 10.8 kDa | 
| Protein Sequence | >RC213211 representing NM_032321 Red=Cloning site Green=Tags(s) MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDIL CDALQQWACNNIKYHDIPYIESEGP myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_115697 | 
| RefSeq Size | 705 | 
| RefSeq ORF | 285 | 
| Synonyms | smAKAP | 
| Locus ID | 84281 | 
| Cytogenetics | 2q32.2 | 
| Summary | Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC403155 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC420957 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC420958 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC420959 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY403155 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 4 | CNY 3080.00 | |
| LY420957 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 1 | CNY 3080.00 | |
| LY420958 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 3 | CNY 3080.00 | |
| LY420959 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 2 | CNY 3080.00 | |
| PH302987 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035984) | CNY 19520.00 | |
| PH313362 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035985) | CNY 14250.00 | |
| PH324360 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035986) | CNY 14250.00 | |
| TP302987 | Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP313211 | Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 4, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP313362 | Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 3, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP324360 | Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 2, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 
其它C2orf88产品

 
                        

 
        