MEMO1 (NM_015955) Human Mass Spec Standard
CAT#: PH313245
MEMO1 MS Standard C13 and N15-labeled recombinant protein (NP_057039)
View other "MEMO1" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | MEMO1 MS Standard C13 and N15-labeled recombinant protein (NP_057039) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC213245 | 
| Predicted MW | 33.7 kDa | 
| Protein Sequence | 
                 >RC213245 protein sequence 
Red=Cloning site Green=Tags(s) MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSI TRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYT AKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIY RSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCR NWQDSSVSYAAGALTVH myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_057039 | 
| RefSeq Size | 1878 | 
| RefSeq ORF | 891 | 
| Synonyms | C2orf4; CGI-27; MEMO; NS5ATP7 | 
| Locus ID | 51072 | 
| Cytogenetics | 2p22.3 | 
| Summary | May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Is required for breast carcinoma cell migration.[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC414307 | MEMO1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC427942 | MEMO1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY414307 | Transient overexpression lysate of mediator of cell motility 1 (MEMO1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY427942 | Transient overexpression lysate of mediator of cell motility 1 (MEMO1), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| TP313245 | Recombinant protein of human mediator of cell motility 1 (MEMO1), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
