EDDM3B (NM_022360) Human Mass Spec Standard
CAT#: PH313305
EDDM3B MS Standard C13 and N15-labeled recombinant protein (NP_071755)
View other "EDDM3B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | EDDM3B MS Standard C13 and N15-labeled recombinant protein (NP_071755) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213305 |
| Predicted MW | 17.6 kDa |
| Protein Sequence |
>RC213305 protein sequence
Red=Cloning site Green=Tags(s) MASSVKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIY ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLK MVEPIGN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071755 |
| RefSeq Size | 897 |
| RefSeq ORF | 441 |
| Synonyms | EP3B; FAM12B; HE3-BETA; HE3B; RAM2 |
| Locus ID | 64184 |
| Cytogenetics | 14q11.2 |
| Summary | Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411686 | EDDM3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411686 | Transient overexpression lysate of epididymal protein 3B (EDDM3B) |
CNY 3080.00 |
|
| TP313305 | Recombinant protein of human family with sequence similarity 12, member B (epididymal) (FAM12B), 20 µg |
CNY 2900.00 |
