LOX (NM_002317) Human Mass Spec Standard
CAT#: PH313323
LOX MS Standard C13 and N15-labeled recombinant protein (NP_002308)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Product images
                    
                Specifications
| Product Data | |
| Description | LOX MS Standard C13 and N15-labeled recombinant protein (NP_002308) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC213323 | 
| Predicted MW | 46.8 kDa | 
| Protein Sequence | 
                 >RC213323 representing NM_002317 
Red=Cloning site Green=Tags(s) MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSLGSQYQPQRRR DPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPTARHWFQAGYSTSRAREAGAS RAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQY GLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPS RPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPG CYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_002308 | 
| RefSeq Size | 1946 | 
| RefSeq ORF | 1251 | 
| Synonyms | AAT10 | 
| Locus ID | 4015 | 
| Cytogenetics | 5q23.1 | 
| Summary | This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. The copper-dependent amine oxidase activity of this enzyme functions in the crosslinking of collagens and elastin, while the propeptide may play a role in tumor suppression. In addition, defects in this gene have been linked with predisposition to thoracic aortic aneurysms and dissections. [provided by RefSeq, Jul 2016] | 
| Protein Families | Druggable Genome, Secreted Protein | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400843 | LOX HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400843 | Transient overexpression lysate of lysyl oxidase (LOX) | 
                                                     CNY 3080.00  | 
                                            |
| TP313323 | Recombinant protein of human lysyl oxidase (LOX), 20 µg | 
                                                     CNY 2900.00  | 
                                            |
| TP700002 | Recombinant protein of N-terminal propeptide (LOXPP) of human lysyl oxidase (LOX), with C-terminal DDK/His tag, expressed in human cells | 
                                                     CNY 6650.00  | 
                                            |
| TP790154 | Purified recombinant protein of Human lysyl oxidase (LOX), with C-terminal DDK tag, secretory expressed in CHO cells, 20ug | 
                                                     CNY 6650.00  | 
                                            
