LST1 (NM_205839) Human Mass Spec Standard
CAT#: PH313326
LST1 MS Standard C13 and N15-labeled recombinant protein (NP_995311)
View other "LST1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LST1 MS Standard C13 and N15-labeled recombinant protein (NP_995311) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213326 |
Predicted MW | 10.8 kDa |
Protein Sequence |
>RC213326 representing NM_205839
Red=Cloning site Green=Tags(s) MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGP DLRGRDKRGTKEDPRADYACIAENKPT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_995311 |
RefSeq Size | 769 |
RefSeq ORF | 291 |
Synonyms | B144; D6S49E; LST-1 |
Locus ID | 7940 |
Cytogenetics | 6p21.33 |
Summary | The protein encoded by this gene is a membrane protein that can inhibit the proliferation of lymphocytes. Expression of this gene is enhanced by lipopolysaccharide, interferon-gamma, and bacteria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC432498 | LST1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY432498 | Transient overexpression lysate of leukocyte specific transcript 1 (LST1), transcript variant 6 |
CNY 3080.00 |
|
TP313326 | Recombinant protein of human leukocyte specific transcript 1 (LST1), transcript variant 4, 20 µg |
CNY 2900.00 |