AHSA2P (NM_152392) Human Mass Spec Standard
CAT#: PH313490
AHSA2 MS Standard C13 and N15-labeled recombinant protein (NP_689605)
View other "AHSA2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | AHSA2 MS Standard C13 and N15-labeled recombinant protein (NP_689605) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213490 |
| Predicted MW | 15.7 kDa |
| Protein Sequence |
>RC213490 protein sequence
Red=Cloning site Green=Tags(s) MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKELTNKKI IMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLTPLNG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689605 |
| RefSeq Size | 3059 |
| RefSeq ORF | 411 |
| Synonyms | Hch1 |
| Locus ID | 130872 |
| Cytogenetics | 2p15 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407560 | AHSA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407560 | Transient overexpression lysate of AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) (AHSA2) |
CNY 3080.00 |
|
| TP313490 | Recombinant protein of human AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) (AHSA2), 20 µg |
CNY 2900.00 |
