ARMETL1 (CDNF) (NM_001029954) Human Mass Spec Standard
CAT#: PH313572
CDNF MS Standard C13 and N15-labeled recombinant protein (NP_001025125)
View other "ARMETL1" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | CDNF MS Standard C13 and N15-labeled recombinant protein (NP_001025125) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC213572 | 
| Predicted MW | 21 kDa | 
| Protein Sequence | 
                 >RC213572 protein sequence 
Red=Cloning site Green=Tags(s) MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISF CLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLR KMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001025125 | 
| RefSeq Size | 1330 | 
| RefSeq ORF | 561 | 
| Synonyms | ARMETL1 | 
| Locus ID | 441549 | 
| Cytogenetics | 10p13 | 
| Summary | Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra (By similarity).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC422270 | CDNF HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY422270 | Transient overexpression lysate of cerebral dopamine neurotrophic factor (CDNF) | 
                                                     CNY 3080.00  | 
                                            |
| TP313572 | Recombinant protein of human arginine-rich, mutated in early stage tumors-like 1 (ARMETL1), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP720771 | Purified recombinant protein of Human cerebral dopamine neurotrophic factor (CDNF) | 
                                                     CNY 1800.00  | 
                                            
其它ARMETL1产品
