HPS1 (NM_182639) Human Mass Spec Standard
CAT#: PH313679
HPS1 MS Standard C13 and N15-labeled recombinant protein (NP_872577)
View other "HPS1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HPS1 MS Standard C13 and N15-labeled recombinant protein (NP_872577) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213679 |
Predicted MW | 36.3 kDa |
Protein Sequence |
>RC213679 representing NM_182639
Red=Cloning site Green=Tags(s) MKCVLVATEGAEVLFYWTDQEFEESLRLKFGQSENEEEELPALEDQLSTLLAPVIISSMTMLEKLSDTYT CFSTENGNFLYVLHLFGECLFIAINGDHTESEGDLRRKLYVLKYLFEVHFGLVTVDGHLIRKELRPPDLA QRVQLWEHFQSLLWTYSRLREQEQCFAVEALERLIHPQLCELCIEALERHVIQAVNTSPERGGEEALHAF LLVHSKLLAFYSSHSASSLRPADLLALILLVQDLYPSESTAEDDIQPSPRRARSSQNIPVQQAWSPHSTG PTGGSSAETETDSFSLPEEYFTPAPSPGDQSSGEDRRKAGGNNS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_872577 |
RefSeq Size | 1625 |
RefSeq ORF | 972 |
Synonyms | BLOC3S1; HPS |
Locus ID | 3257 |
Cytogenetics | 10q24.2 |
Summary | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is a component of three different protein complexes termed biogenesis of lysosome-related organelles complex (BLOC)-3, BLOC4, and BLOC5. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 1. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on chromosome 22. [provided by RefSeq, Aug 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424869 | HPS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY424869 | Transient overexpression lysate of Hermansky-Pudlak syndrome 1 (HPS1), transcript variant 1 |
CNY 4840.00 |
|
PH319526 | HPS1 MS Standard C13 and N15-labeled recombinant protein (NP_000186) |
CNY 14250.00 |
|
TP313679 | Recombinant protein of human Hermansky-Pudlak syndrome 1 (HPS1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP319526 | Recombinant protein of human Hermansky-Pudlak syndrome 1 (HPS1), transcript variant 1, 20 µg |
CNY 2900.00 |