Nectin 2 (NECTIN2) (NM_001042724) Human Mass Spec Standard
CAT#: PH313693
PVRL2 MS Standard C13 and N15-labeled recombinant protein (NP_001036189)
View other "Nectin 2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PVRL2 MS Standard C13 and N15-labeled recombinant protein (NP_001036189) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213693 |
Predicted MW | 57.74 kDa |
Protein Sequence |
>RC213693 representing NM_001042724
Red=Cloning site Green=Tags(s) MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTW QRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTC EFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVS GTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDAT LSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETP NTAGAGATGGIIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDV SLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001036189 |
RefSeq Size | 2869 |
RefSeq ORF | 1614 |
Synonyms | CD112; HVEB; PRR2; PVRL2; PVRR2 |
Locus ID | 5819 |
Cytogenetics | 19q13.32 |
Summary | This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Adherens junction, Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419084 | PVRL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429120 | PVRL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419084 | Transient overexpression lysate of poliovirus receptor-related 2 (herpesvirus entry mediator B) (PVRL2), transcript variant alpha |
CNY 3080.00 |
|
TP313693 | Recombinant protein of human poliovirus receptor-related 2 (herpesvirus entry mediator B) (PVRL2), transcript variant delta, 20 µg |
CNY 2900.00 |
|
TP720371 | Recombinant protein of human poliovirus receptor-related 2 (herpesvirus entry mediator B) (PVRL2), transcript variant delta |
CNY 1800.00 |
其它Nectin 2产品