Ephrin A2 (EFNA2) (NM_001405) Human Mass Spec Standard
CAT#: PH313728
EFNA2 MS Standard C13 and N15-labeled recombinant protein (NP_001396)
View other "Ephrin A2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | EFNA2 MS Standard C13 and N15-labeled recombinant protein (NP_001396) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213728 |
Predicted MW | 23.88 kDa |
Protein Sequence |
>RC213728 representing NM_001405
Red=Cloning site Green=Tags(s) MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLD IYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGF EFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTL LGS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001396 |
RefSeq Size | 642 |
RefSeq ORF | 639 |
Synonyms | ELF-1; EPLG6; HEK7-L; LERK-6; LERK6 |
Locus ID | 1943 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
其它Ephrin A2产品