DCL 1 (CD302) (NM_014880) Human Mass Spec Standard
CAT#: PH313785
CD302 MS Standard C13 and N15-labeled recombinant protein (NP_055695)
View other "DCL 1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CD302 MS Standard C13 and N15-labeled recombinant protein (NP_055695) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213785 |
| Predicted MW | 26 kDa |
| Protein Sequence |
>RC213785 representing NM_014880
Red=Cloning site Green=Tags(s) MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEE ENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKK GNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQ SPYNEDCVLVVGEENEYPVQFD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055695 |
| RefSeq Size | 3740 |
| RefSeq ORF | 696 |
| Synonyms | BIMLEC; CLEC13A; DCL-1; DCL1 |
| Locus ID | 9936 |
| Cytogenetics | 2q24.2 |
| Summary | CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis (Kato et al., 2007 [PubMed 17947679]).[supplied by OMIM, Aug 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402391 | CD302 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434014 | CD302 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402391 | Transient overexpression lysate of CD302 molecule (CD302) |
CNY 3080.00 |
|
| LY434014 | Transient overexpression lysate of CD302 molecule (CD302), transcript variant 2 |
CNY 3080.00 |
|
| TP313785 | Recombinant protein of human CD302 molecule (CD302), 20 µg |
CNY 2900.00 |
