Paxillin (PXN) (NM_002859) Human Mass Spec Standard
CAT#: PH313811
PXN MS Standard C13 and N15-labeled recombinant protein (NP_002850)
View other "Paxillin" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PXN MS Standard C13 and N15-labeled recombinant protein (NP_002850) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213811 |
| Predicted MW | 60.8 kDa |
| Protein Sequence |
>RC213811 representing NM_002859
Red=Cloning site Green=Tags(s) MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQ PSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGS NLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGL EDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKFMA QGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVC THCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEG FHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCE VHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002850 |
| RefSeq Size | 3595 |
| RefSeq ORF | 1671 |
| Locus ID | 5829 |
| Cytogenetics | 12q24.23 |
| Summary | This gene encodes a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. These isoforms exhibit different expression pattern, and have different biochemical, as well as physiological properties (PMID:9054445). [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401010 | PXN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC425922 | PXN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429750 | PXN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401010 | Transient overexpression lysate of paxillin (PXN), transcript variant 2 |
CNY 4840.00 |
|
| LY425922 | Transient overexpression lysate of paxillin (PXN), transcript variant 1 |
CNY 3080.00 |
|
| LY429750 | Transient overexpression lysate of paxillin (PXN), transcript variant 3 |
CNY 3080.00 |
|
| TP313811 | Recombinant protein of human paxillin (PXN), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP760834 | Purified recombinant protein of Human paxillin (PXN), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Paxillin产品
