IFITM5 (NM_001025295) Human Mass Spec Standard
CAT#: PH313834
IFITM5 MS Standard C13 and N15-labeled recombinant protein (NP_001020466)
View other "IFITM5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | IFITM5 MS Standard C13 and N15-labeled recombinant protein (NP_001020466) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213834 |
Predicted MW | 14.2 kDa |
Protein Sequence |
>RC213834 representing NM_001025295
Red=Cloning site Green=Tags(s) MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVG DLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001020466 |
RefSeq Size | 733 |
RefSeq ORF | 396 |
Synonyms | BRIL; DSPA1; fragilis4; Hrmp1; OI5 |
Locus ID | 387733 |
Cytogenetics | 11p15.5 |
Summary | This gene encodes a membrane protein thought to play a role in bone mineralization. This gene is located on chromosome 11 in a cluster of related genes which are induced by interferon, however, this gene has not been shown to be interferon inducible. A similar gene, located in a gene cluster on mouse chromosome 7, is a member of the interferon-inducible fragilis gene family. The mouse gene encodes a transmembrane protein described as participating in germ cell competence. A mutation in the 5' UTR of this gene has been associated with osteogenesis imperfecta type V (PMID: 22863190, 22863195). [provided by RefSeq, Aug 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422431 | IFITM5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422431 | Transient overexpression lysate of interferon induced transmembrane protein 5 (IFITM5) |
CNY 3080.00 |
|
TP313834 | Recombinant protein of human interferon induced transmembrane protein 5 (IFITM5), 20 µg |
CNY 2900.00 |