PYDC2 (NM_001083308) Human Mass Spec Standard
CAT#: PH314665
PYDC2 MS Standard C13 and N15-labeled recombinant protein (NP_001076777)
View other "PYDC2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PYDC2 MS Standard C13 and N15-labeled recombinant protein (NP_001076777) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214665 |
Predicted MW | 10.6 kDa |
Protein Sequence |
>RC214665 representing NM_001083308
Red=Cloning site Green=Tags(s) MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFTSHSCSYWAGM AAIQVFEKMNQTHLSGRADEHCVMPPP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001076777 |
RefSeq Size | 294 |
RefSeq ORF | 291 |
Synonyms | cPOP2; POP2 |
Locus ID | 152138 |
Cytogenetics | 3q28 |
Summary | May play a role in innate immunity by disrupting the interaction between PYCARD and NLRP3, thereby regulating the NLRP3 inflammasome (PubMed:17339483, PubMed:17178784). May also inhibit NF-kappa-B signaling distally by affecting the nuclear accumulation of RELA (PubMed:17339483, PubMed:24871464).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421211 | PYDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421211 | Transient overexpression lysate of pyrin domain containing 2 (PYDC2) |
CNY 3080.00 |
|
TP314665 | Recombinant protein of human pyrin domain containing 2 (PYDC2), 20 µg |
CNY 2900.00 |