PRDM7 (NM_052996) Human Mass Spec Standard
CAT#: PH314678
PRDM7 MS Standard C13 and N15-labeled recombinant protein (NP_443722)
View other "PRDM7" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PRDM7 MS Standard C13 and N15-labeled recombinant protein (NP_443722) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214678 |
Predicted MW | 18.4 kDa |
Protein Sequence |
>RC214678 protein sequence
Red=Cloning site Green=Tags(s) MCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPY EGRITEDEEAANSGYSWLITKGRNCYEYVDGKDKSSANWMRTKARDPSMSLMLSGLFKSKISQSTCGTQS LLSELPRTICKKTSPTRESLPRGSESGAAIF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_443722 |
RefSeq Size | 2504 |
RefSeq ORF | 513 |
Synonyms | PFM4; ZNF910 |
Locus ID | 11105 |
Cytogenetics | 16q24.3 |
Summary | This gene encodes a member of a family of proteins that may have roles in transcription and other nuclear processes. The encoded protein contains a KRAB (Kruppel-associated box) domain -A box and a SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain and may function as a histone methyltransferase. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409349 | PRDM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420546 | PRDM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY409349 | Transient overexpression lysate of PR domain containing 7 (PRDM7), transcript variant 2 |
CNY 3080.00 |
|
LY420546 | Transient overexpression lysate of PR domain containing 7 (PRDM7), transcript variant 1 |
CNY 4840.00 |
|
TP314678 | Recombinant protein of human PR domain containing 7 (PRDM7), transcript variant 2, 20 µg |
CNY 2900.00 |