RING finger protein unkempt like (UNKL) (NM_001037125) Human Mass Spec Standard
CAT#: PH314684
UNKL MS Standard C13 and N15-labeled recombinant protein (NP_001032202)
View other "RING finger protein unkempt like" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | UNKL MS Standard C13 and N15-labeled recombinant protein (NP_001032202) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214684 |
| Predicted MW | 31.6 kDa |
| Protein Sequence |
>RC214684 representing NM_001037125
Red=Cloning site Green=Tags(s) MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRD GTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAF AHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKT EQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYSWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001032202 |
| RefSeq Size | 1401 |
| RefSeq ORF | 831 |
| Synonyms | C16orf28; ZC3H5L; ZC3HDC5L |
| Locus ID | 64718 |
| Cytogenetics | 16p13.3 |
| Summary | This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422146 | UNKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434369 | UNKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY422146 | Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 2 |
CNY 3080.00 |
|
| LY434369 | Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 1 |
CNY 4840.00 |
|
| TP301609 | Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP314684 | Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 2, 20 µg |
CNY 2900.00 |
其它RING finger protein unkempt like产品
