SULT1A2 (NM_177528) Human Mass Spec Standard
CAT#: PH314872
SULT1A2 MS Standard C13 and N15-labeled recombinant protein (NP_803564)
View other "SULT1A2" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SULT1A2 MS Standard C13 and N15-labeled recombinant protein (NP_803564) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214872 |
Predicted MW | 34.3 kDa |
Protein Sequence |
>RC214872 protein sequence
Red=Cloning site Green=Tags(s) MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC HRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY HFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF VGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY AEKMAGCSLSFRSEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_803564 |
RefSeq Size | 1348 |
RefSeq ORF | 885 |
Synonyms | HAST4; P-PST; P-PST 2; ST1A2; STP2; TSPST2 |
Locus ID | 6799 |
Cytogenetics | 16p11.2 |
Summary | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Two alternatively spliced variants that encode the same protein have been described. [provided by RefSeq, Jul 2008] |
Protein Pathways | Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406097 | SULT1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420734 | SULT1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406097 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 2 |
CNY 3080.00 |
|
LY420734 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 1 |
CNY 3080.00 |
|
PH324689 | SULT1A2 MS Standard C13 and N15-labeled recombinant protein (NP_001045) |
CNY 19520.00 |
|
TP314872 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP324689 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720860 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 2 |
CNY 1800.00 |
其它SULT1A2产品